HPA006731

USP10 antibody from Atlas Antibodies
KIAA0190, UBPO
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA006731
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006731, RRID:AB_1080495
Product name
Anti-USP10
Provider product page
Atlas Antibodies - HPA006731
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KITPDGITKEASYGSIDCQYPGSALALDGSSNVEA
EVLENDGVSGGLGQRERKKKKKRPPGYYSYLKDGG
DDSISTEALVNGHANSAVPNSVSAEDAEFMGDMPP
PLTPRTCNSPQNSTDS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -