HPA006731

USP10 antibody from Atlas Antibodies
KIAA0190, UBPO
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA006731
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006731, RRID:AB_889030
Product name
Anti-USP10
Provider product page
Atlas Antibodies - HPA006731
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KITPDGITKEASYGSIDCQYPGSALALDGSSNVEA
EVLENDGVSGGLGQRERKKKKKRPPGYYSYLKDGG
DDSISTEALVNGHANSAVPNSVSAEDAEFMGDMPP
PLTPRTCNSPQNSTDS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -