HPA006731

USP10 antibody from Sigma-Aldrich
KIAA0190, UBPO
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006731
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006731, RRID:AB_1080495
Product name
Anti-USP10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006731
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KITPDGITKEASYGSIDCQYPGSALALDGSSNVEA
EVLENDGVSGGLGQRERKKKKKRPPGYYSYLKDGG
DDSISTEALVNGHANSAVPNSVSAEDAEFMGDMPP
PLTPRTCNSPQNSTDS
Storage
-20C
Provider Type Product Number
- No reagents -