HPA006937

USP31 antibody from Atlas Antibodies
KIAA1203
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006937
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006937, RRID:AB_1080523
Product name
Anti-USP31
Provider product page
Atlas Antibodies - HPA006937
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LASLSESVEMTGERSEDDGGFSTRPFVRSVQRQSL
SSRSSVTSPLAVNENCMRPSWSLSAKLQMRSNSPS
RFSGDSPIHSSASTLEKIGEAADDKVSISCFGSLR
NLSSSYQEPSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -