HPA022869

PTGES3L-AARSD1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022869
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022869, RRID:AB_1844411
Product name
Anti-AARSD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022869
Antibody type
Polyclonal
Antigen
Alanyl-tRNA synthetase domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGVVILHRKEGDSEFMNIIANEIGSEETLLFLTVG
DEKGGGLFLLAGPPASVETLGPRVAEVLEGKGAGK
KGRFQGKATKMSRRMEAQALLQDYISTQSAKE
Storage
-20C
Provider Type Product Number
- No reagents -