HPA020300

COG5 antibody from Atlas Antibodies
GOLTC1, GTC90
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020300
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020300, RRID:AB_2081406
Product name
Anti-COG5
Provider product page
Atlas Antibodies - HPA020300
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SFWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVS
HICFIEEIVKDGQPEIFYTFWNSVTQALSSQFHMA
TNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQH
IQGNFNASGTTDLYVD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -