HPA020300

COG5 antibody from MilliporeSigma / Merck KGaA
GOLTC1, GTC90
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020300
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-COG5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA020300
Antibody type
Polyclonal
Antigen
Conserved oligomeric Golgi complex subunit 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SFWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVS
HICFIEEIVKDGQPEIFYTFWNSVTQALSSQFHMA
TNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQH
IQGNFNASGTTDLYVD
Storage
-20C