HPA006804

HPN antibody from Atlas Antibodies
TMPRSS1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006804
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006804, RRID:AB_1079046
Product name
Anti-HPN
Provider product page
Atlas Antibodies - HPA006804
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALT
HSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVI
SVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTS
LGRWPWQVSLRYDGAHL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -