HPA006804

HPN antibody from Sigma-Aldrich
TMPRSS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006804
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006804, RRID:AB_1079046
Product name
Anti-HPN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006804
Antibody type
Polyclonal
Antigen
Serine protease hepsin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALT
HSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVI
SVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTS
LGRWPWQVSLRYDGAHL
Storage
-20C
Provider Type Product Number
- No reagents -