Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA006752 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006752, RRID:AB_1080529
- Product name
- Anti-USP42
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PQLPSHMIKNPPHLNGTGPLKDTPSSSMSSPNGNS
SVNRASPVNASASVQNWSVNRSSVIPEHPKKQKIT
ISIHNKLPVRQCQSQPNLHSNSLENPTKPVPSSTI
TNSAVQSTSNASTMSVSSKVTK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Ubiquitin-specific peptidase 42 (USP42) functions to deubiquitylate histones and regulate transcriptional activity.
Regulation of p53 stability and function by the deubiquitinating enzyme USP42.
Hock AK, Vigneron AM, Vousden KH
The Journal of biological chemistry 2014 Dec 12;289(50):34862-70
The Journal of biological chemistry 2014 Dec 12;289(50):34862-70
Regulation of p53 stability and function by the deubiquitinating enzyme USP42.
Hock AK, Vigneron AM, Carter S, Ludwig RL, Vousden KH
The EMBO journal 2011 Nov 15;30(24):4921-30
The EMBO journal 2011 Nov 15;30(24):4921-30
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong nuclear cytoplasmic positivity in cells in tubules and cells in glomeruli.
- Sample type
- HUMAN