HPA006752

USP42 antibody from Sigma-Aldrich
FLJ12697
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006752
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006752, RRID:AB_1080529
Product name
Anti-USP42 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006752
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 42 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQLPSHMIKNPPHLNGTGPLKDTPSSSMSSPNGNS
SVNRASPVNASASVQNWSVNRSSVIPEHPKKQKIT
ISIHNKLPVRQCQSQPNLHSNSLENPTKPVPSSTI
TNSAVQSTSNASTMSVSSKVTK
Storage
-20C
Provider Type Product Number
- No reagents -