Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002303-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002303-M02, RRID:AB_565742
- Product name
- FOXC2 monoclonal antibody (M02), clone 2H3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FOXC2.
- Antigen sequence
AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFN
SHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRH
AAPYSYDCTKY- Isotype
- IgG
- Antibody clone number
- 2H3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references FOXC2 expression is associated with tumor proliferation and invasion potential in oral tongue squamous cell carcinoma.
MiR-520h-mediated FOXC2 regulation is critical for inhibition of lung cancer progression by resveratrol.
FOXC2 is a novel prognostic factor in human esophageal squamous cell carcinoma.
Imayama N, Yamada S, Yanamoto S, Naruse T, Matsushita Y, Takahashi H, Seki S, Fujita S, Ikeda T, Umeda M
Pathology oncology research : POR 2015 Jul;21(3):783-91
Pathology oncology research : POR 2015 Jul;21(3):783-91
MiR-520h-mediated FOXC2 regulation is critical for inhibition of lung cancer progression by resveratrol.
Yu YH, Chen HA, Chen PS, Cheng YJ, Hsu WH, Chang YW, Chen YH, Jan Y, Hsiao M, Chang TY, Liu YH, Jeng YM, Wu CH, Huang MT, Su YH, Hung MC, Chien MH, Chen CY, Kuo ML, Su JL
Oncogene 2013 Jan 24;32(4):431-43
Oncogene 2013 Jan 24;32(4):431-43
FOXC2 is a novel prognostic factor in human esophageal squamous cell carcinoma.
Nishida N, Mimori K, Yokobori T, Sudo T, Tanaka F, Shibata K, Ishii H, Doki Y, Mori M
Annals of surgical oncology 2011 Feb;18(2):535-42
Annals of surgical oncology 2011 Feb;18(2):535-42
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FOXC2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to FOXC2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to FOXC2 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol