Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002300-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002300-M04, RRID:AB_875588
- Product name
- FOXL1 monoclonal antibody (M04), clone 1C3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant FOXL1.
- Antigen sequence
MFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSA
EAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPS
PPAPLHWPGTASPNEDAGDAAQGAAAVAVGQAART
GDGP- Isotype
- IgG
- Antibody clone number
- 1C3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Foxl1 inhibits tumor invasion and predicts outcome in human renal cancer.
Yang FQ, Yang FP, Li W, Liu M, Wang GC, Che JP, Huang JH, Zheng JH
International journal of clinical and experimental pathology 2014;7(1):110-22
International journal of clinical and experimental pathology 2014;7(1):110-22
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to FOXL1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol