HPA011800

KAZALD1 antibody from MilliporeSigma / Merck KGaA
FKSG28, FKSG40
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011800
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA011800, RRID:AB_1852082
Product name
Anti-KAZALD1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA011800
Antibody type
Polyclonal
Antigen
Kazal-type serine protease inhibitor domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQ
FRGGPQRFEVTGWLQIQAVRPSDEGTYRCLARNAL
GQVEAPASLTVLTPDQLNSTGIPQLRSLNLVPE
Storage
-20C
Provider Type Product Number
- No reagents -