HPA029215

antibody from Atlas Antibodies

Targeting: BCAP29 BAP29, DKFZp686M2086

Antibody data

Submit

Validation data

Product number: HPA029215 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA029215, RRID:AB_10602331
Product name: Anti-BCAP29
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LITQLAKELSNKGVLKTQAENTNKAAKKFMEENEK LKRILKSHGKDEECVLEAE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

BCAP29 protein structure - HPA029215 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and pancreas tissues using Anti-BCAP29 antibody. Corresponding BCAP29 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, pancreas, testis and thyroid gland using Anti-BCAP29 antibody HPA029215 (A) shows similar protein distribution across tissues to independent antibody HPA049694 (B).
Antibody #2 product nr: HPA049694
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-BCAP29 antibody HPA029215.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human thyroid gland using Anti-BCAP29 antibody HPA029215.
Sample type: HUMAN