HPA006754

PITRM1 antibody from Sigma-Aldrich
hMP1, KIAA1104, MP1, PreP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006754
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006754, RRID:AB_1079623
Product name
Anti-PITRM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006754
Antibody type
Polyclonal
Antigen
Presequence protease, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTA
SDYTLYPFSTQNPKDFQNLLSVYLDATFFPCLREL
DFWQEGWRLEHENPSDPQTPLVFKGVVFNEMKGAF
TDNERIFSQHLQNRLLPDHTYSVVS
Storage
-20C
Provider Type Product Number
- No reagents -