HPA007288

USP46 antibody from Sigma-Aldrich
FLJ12552
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007288
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007288, RRID:AB_1080531
Product name
Anti-USP46 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007288
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 46 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQN
GKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETR
CLNCETVSSKDEDFLDLSVDVEQN
Storage
-20C
Provider Type Product Number
- No reagents -