HPA026958

JPH3 antibody from Sigma-Aldrich
CAGL237, HDL2, JP-3, JP3, TNRC22
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026958
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026958, RRID:AB_1852030
Product name
Anti-JPH3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026958
Antibody type
Polyclonal
Antigen
Junctophilin-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STGTPLQQESPELYRKGTTPSDLTPDDSPLQSFPT
SPAATPPPAPAARNKVAHFSRQVSVDEERGGDIQM
LLEGRAGDCARSSWGEEQAGGSRGVRSGALRGGLL
VDDFR
Storage
-20C
Provider Type Product Number
- No reagents -