HPA026699

CBLL1 antibody from Sigma-Aldrich
FLJ23109, HAKAI, RNF188
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026699
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026699, RRID:AB_1846104
Product name
Anti-CBLL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026699
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase Hakai recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANK
AKPAPRTQRTINRMPAKAPPGDEEGFDYNEEERYD
CKGGELFANQRRFPGHLFWDFQINILGEKDDTPVH
FC
Storage
-20C
Provider Type Product Number
- No reagents -