HPA026445

DLGAP3 antibody from Sigma-Aldrich
DAP3, SAPAP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026445
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026445, RRID:AB_1847733
Product name
Anti-DLGAP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026445
Antibody type
Polyclonal
Antigen
Disks large-associated protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSDSGFLAGGRPPGEPGGPFCLEGPDGSYRDLSFK
GRSGGSEGRCLACTGMSMSLDGQSVKRSAWHTMMV
SQGRDGYPGAGPGKGLLGPETKAKARTYHYLQVPQ
Storage
-20C
Provider Type Product Number
- No reagents -