Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002941-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002941-A01, RRID:AB_489543
- Product name
- GSTA4 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant GSTA4.
- Antigen sequence
EEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGS
KKKPPPDEIYVRTVYNIFRP- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Effects of cypermethrin on monoamine transporters, xenobiotic metabolizing enzymes and lipid peroxidation in the rat nigrostriatal system.
Carbonylation of adipose proteins in obesity and insulin resistance: identification of adipocyte fatty acid-binding protein as a cellular target of 4-hydroxynonenal.
Tiwari MN, Singh AK, Ahmad I, Upadhyay G, Singh D, Patel DK, Singh C, Prakash O, Singh MP
Free radical research 2010 Dec;44(12):1416-24
Free radical research 2010 Dec;44(12):1416-24
Carbonylation of adipose proteins in obesity and insulin resistance: identification of adipocyte fatty acid-binding protein as a cellular target of 4-hydroxynonenal.
Grimsrud PA, Picklo MJ Sr, Griffin TJ, Bernlohr DA
Molecular & cellular proteomics : MCP 2007 Apr;6(4):624-37
Molecular & cellular proteomics : MCP 2007 Apr;6(4):624-37
No comments: Submit comment
No validations: Submit validation data