Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310872 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 6 (ST6GALNAC6) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ST6GALNAC6 antibody: synthetic peptide directed towards the C terminal of human ST6GALNAC6
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRV
FSSWA QLYGITFSHP- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification and expression of a sialyltransferase responsible for the synthesis of disialylgalactosylgloboside in normal and malignant kidney cells: downregulation of ST6GalNAc VI in renal cancers.
Senda M, Ito A, Tsuchida A, Hagiwara T, Kaneda T, Nakamura Y, Kasama K, Kiso M, Yoshikawa K, Katagiri Y, Ono Y, Ogiso M, Urano T, Furukawa K, Oshima S, Furukawa K
The Biochemical journal 2007 Mar 15;402(3):459-70
The Biochemical journal 2007 Mar 15;402(3):459-70
No comments: Submit comment
No validations: Submit validation data