HPA018890

ST6GALNAC6 antibody from Sigma-Aldrich
SIAT7F, ST6GALNACVI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018890
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018890, RRID:AB_1857531
Product name
Anti-ST6GALNAC6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018890
Antibody type
Polyclonal
Antigen
Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMND
APTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFV
NRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVF
PNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWL
STGWF
Storage
-20C
Provider Type Product Number
- No reagents -