HPA007286

SPINK4 antibody from Atlas Antibodies
MGC133107, PEC-60
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007286
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007286, RRID:AB_1080083
Product name
Anti-SPINK4
Provider product page
Atlas Antibodies - HPA007286
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTN
ECQLCLARIKTKQDIQIMKDGK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -