HPA007286

SPINK4 antibody from Sigma-Aldrich
MGC133107, PEC-60
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007286
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007286, RRID:AB_1080083
Product name
Anti-SPINK4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007286
Antibody type
Polyclonal
Antigen
Serine protease inhibitor Kazal-type 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTN
ECQLCLARIKTKQDIQIMKDGK
Storage
-20C
Provider Type Product Number
- No reagents -