Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008521-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008521-M04, RRID:AB_581689
- Product name
- GCM1 monoclonal antibody (M04), clone 4E8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GCM1.
- Antigen sequence
QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGR
FIFFQSKGEHDHPKPETKLEAEA*- Isotype
- IgG
- Antibody clone number
- 4E8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- GCM1 monoclonal antibody (M04), clone 4E8. Western Blot analysis of GCM1 expression in FHs 173 WE.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GCM1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to GCM1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol