Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184315 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glial Cells Missing Homolog 1 (Drosophila) (GCM1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GCM1 antibody: synthetic peptide directed towards the N terminal of human GCM1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQE
WPDSY AKHIYSSEDK- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references The c-Myc-regulated microRNA-17~92 (miR-17~92) and miR-106a~363 clusters target hCYP19A1 and hGCM1 to inhibit human trophoblast differentiation.
Where polarity meets fusion: role of Par6 in trophoblast differentiation during placental development and preeclampsia.
Glial cell missing-1 mediates over-expression of tissue inhibitor of metalloproteinase-4 in severe pre-eclamptic placental villi.
Glial cell missing-1 transcription factor is required for the differentiation of the human trophoblast.
GCMa regulates the syncytin-mediated trophoblastic fusion.
Kumar P, Luo Y, Tudela C, Alexander JM, Mendelson CR
Molecular and cellular biology 2013 May;33(9):1782-96
Molecular and cellular biology 2013 May;33(9):1782-96
Where polarity meets fusion: role of Par6 in trophoblast differentiation during placental development and preeclampsia.
Sivasubramaniyam T, Garcia J, Tagliaferro A, Melland-Smith M, Chauvin S, Post M, Todros T, Caniggia I
Endocrinology 2013 Mar;154(3):1296-309
Endocrinology 2013 Mar;154(3):1296-309
Glial cell missing-1 mediates over-expression of tissue inhibitor of metalloproteinase-4 in severe pre-eclamptic placental villi.
Drewlo S, Czikk M, Baczyk D, Lye S, Kingdom J
Human reproduction (Oxford, England) 2011 May;26(5):1025-34
Human reproduction (Oxford, England) 2011 May;26(5):1025-34
Glial cell missing-1 transcription factor is required for the differentiation of the human trophoblast.
Baczyk D, Drewlo S, Proctor L, Dunk C, Lye S, Kingdom J
Cell death and differentiation 2009 May;16(5):719-27
Cell death and differentiation 2009 May;16(5):719-27
GCMa regulates the syncytin-mediated trophoblastic fusion.
Yu C, Shen K, Lin M, Chen P, Lin C, Chang GD, Chen H
The Journal of biological chemistry 2002 Dec 20;277(51):50062-8
The Journal of biological chemistry 2002 Dec 20;277(51):50062-8
No comments: Submit comment
No validations: Submit validation data