HPA019220

SPATA4 antibody from Sigma-Aldrich
SPEF1B, TSARG2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019220
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019220, RRID:AB_1857420
Product name
Anti-SPATA4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019220
Antibody type
Polyclonal
Antigen
Spermatogenesis-associated protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LILLHMLQRKLGRKLNPEWFDVKPTVGEVTLNHLP
AQASGRRYNLKVKRGRVVPVLPNIGSGGSSHREIH
VKQAGQHSYYSAMKPIRN
Storage
-20C
Provider Type Product Number
- No reagents -