SAB1401997

SPATA4 antibody from Sigma-Aldrich
SPEF1B, TSARG2
ELISA
Recommended by provider

Antibody data

Product number
SAB1401997
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401997, RRID:AB_10608417
Product name
Monoclonal Anti-SPATA4 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401997
Antibody type
Monoclonal
Antigen
SPATA4 (NP_653245, 206 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
NELKAEFLILLHMLQRKLGRKLNPEWFDVKPTVGE
VTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGG
SSHREIHVKQAGQHSYYSAMKPIRNMDKKP*
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -