ABIN635954

antibody from antibodies-online

Targeting: PI3 cementoin, ELAFIN, ESI, SKALP, WAP3, WFDC14

Western blot

Antibody data

Submit

Validation data

Product number: ABIN635954 - Provider product page
Provider: antibodies-online
Product name: anti-Peptidase Inhibitor 3, Skin-Derived (PI3) antibody
Antibody type: Polyclonal
Antigen: PI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAM
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

PI3 protein structure - ABIN635954 shown in red.