HPA017737

PI3 antibody from Sigma-Aldrich
cementoin, ELAFIN, ESI, SKALP, WAP3, WFDC14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017737
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017737, RRID:AB_1848107
Product name
Anti-PI3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017737
Antibody type
Polyclonal
Antigen
Elafin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEP
VKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCP
GIKKCCEGSCGMA
Storage
-20C
Provider Type Product Number
- No reagents -