HPA017737

PI3 antibody from Atlas Antibodies
cementoin, ELAFIN, ESI, SKALP, WAP3, WFDC14

Antibody data

Product number
HPA017737
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017737, RRID:AB_1848107
Product name
Anti-PI3
Provider product page
Atlas Antibodies - HPA017737
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEP
VKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCP
GIKKCCEGSCGMA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.