HPA009067

SPINK5 antibody from Atlas Antibodies
DKFZp686K19184, FLJ21544, FLJ97536, FLJ97596, FLJ99794, LEKTI, LETKI, NETS, NS, VAKTI
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009067
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009067, RRID:AB_888883
Product name
Anti-SPINK5
Provider product page
Atlas Antibodies - HPA009067
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DGRLGCTRENDPVLGPDGKTHGNKCAMCAELFLKE
AENAKREGETRIRRNAEKDFCKEYEKQVRNGRLFC
TRESDPVRGPDGRMHGNKCALCAEIFKQRFSEENS
KTDQN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -