HPA011351

SPINK5 antibody from Sigma-Aldrich
DKFZp686K19184, FLJ21544, FLJ97536, FLJ97596, FLJ99794, LEKTI, LETKI, NETS, NS, VAKTI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011351
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011351, RRID:AB_1857447
Product name
Anti-SPINK5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011351
Antibody type
Polyclonal
Antigen
Serine protease inhibitor Kazal-type 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQEERARAKAKREAAKEICSEFRDQVRNGTLICTR
EHNPVRGPDGKMHGNKCAMCASVFKLEEEEKKNDK
EEKGKVEAEKVKREAVQELCSEYRHYVRNGRLPC
Storage
-20C
Provider Type Product Number
- No reagents -