Antibody data

Product number
HPA021771
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021771, RRID:AB_1846689
Product name
Anti-CHRDL2
Provider product page
Atlas Antibodies - HPA021771
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RVLVHTSVSPSPDNLRRFALEHEASDLVEIYLWKL
VKGIFHLTQIKKVRKQDFQKEAQHFRLLAGPHEGH
WNVFLAQTLELKVTASPDKVTKT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.