HPA021771

CHRDL2 antibody from Sigma-Aldrich
BNF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021771
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021771, RRID:AB_1846689
Product name
Anti-CHRDL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021771
Antibody type
Polyclonal
Antigen
Chordin-like protein 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RVLVHTSVSPSPDNLRRFALEHEASDLVEIYLWKL
VKGIFHLTQIKKVRKQDFQKEAQHFRLLAGPHEGH
WNVFLAQTLELKVTASPDKVTKT
Storage
-20C
Provider Type Product Number
- No reagents -