HPA031602

LRRC1 antibody from MilliporeSigma / Merck KGaA
dJ523E19.1, FLJ10775, FLJ11834, LANO
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031602
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031602, RRID:AB_10599713
Product name
Anti-LRRC1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031602
Antibody type
Polyclonal
Antigen
leucine rich repeat containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KALWLSDNQSQPLLTFQTDTDYTTGEKILTCVLLP
QLPSEPTCQENLPRCGALENLVNDVSDE
Storage
-20C
Provider Type Product Number
- No reagents -