HPA016952

USP30 antibody from Sigma-Aldrich
FLJ40511, MGC10702
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016952
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016952, RRID:AB_1858680
Product name
Anti-USP30 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016952
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 30 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIH
LQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLL
GHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQP
GAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDY
SSST
Storage
-20C
Provider Type Product Number
- No reagents -