HPA016952

USP30 antibody from Atlas Antibodies
FLJ40511, MGC10702

Antibody data

Product number
HPA016952
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016952, RRID:AB_1858680
Product name
Anti-USP30
Provider product page
Atlas Antibodies - HPA016952
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIH
LQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLL
GHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQP
GAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDY
SSST
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.