HPA019948

antibody from Atlas Antibodies

Targeting: RUVBL1 ECP54, INO80H, NMP238, Pontin52, RVB1, TIH1, TIP49, TIP49a

Antibody data

Submit

Validation data

Product number: HPA019948 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA019948, RRID:AB_1856514
Product name: Anti-RUVBL1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GPPGTGKTALALAIAQELGSKVPFCPMVGSEVYST EIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELT PCETENPMGG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RUVBL1 protein structure - HPA019948 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using Anti-RUVBL1 antibody. Corresponding RUVBL1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human fallopian tube, kidney, lymph node and testis using Anti-RUVBL1 antibody HPA019948 (A) shows similar protein distribution across tissues to independent antibody HPA019947 (B).
Antibody #2 product nr: HPA019947
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-RUVBL1 antibody HPA019948.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-RUVBL1 antibody HPA019948.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-RUVBL1 antibody HPA019948.
Sample type: HUMAN