HPA019948

RUVBL1 antibody from Atlas Antibodies
ECP54, INO80H, NMP238, Pontin52, RVB1, TIH1, TIP49, TIP49a
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019948
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019948, RRID:AB_1856514
Product name
Anti-RUVBL1
Provider product page
Atlas Antibodies - HPA019948
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GPPGTGKTALALAIAQELGSKVPFCPMVGSEVYST
EIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELT
PCETENPMGG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -