H00008607-M01
antibody from Abnova Corporation
Targeting: RUVBL1
ECP54, INO80H, NMP238, Pontin52, RVB1, TIH1, TIP49, TIP49a
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008607-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008607-M01, RRID:AB_425768
- Product name
- RUVBL1 monoclonal antibody (M01), clone 3G4-1F8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant RUVBL1.
- Antigen sequence
MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQA
ASGLVGQENAREACGVIVELIKSKKMAGRAVLLAG
PPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTE
IKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTP
CETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPS
IFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYA
TEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDV
ANARPQGGQDILSMMGQLMKPKKTEITDKLRGEIN
KVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYL
HRALESSIAPIVIFASNRGNCVIRGTEDITSPHGI
PLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGIN
ISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN
GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYM
K- Isotype
- IgG
- Antibody clone number
- 3G4-1F8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Autoantibodies to RuvBL1 and RuvBL2: a novel systemic sclerosis-related antibody associated with diffuse cutaneous and skeletal muscle involvement.
Kaji K, Fertig N, Medsger TA Jr, Satoh T, Hoshino K, Hamaguchi Y, Hasegawa M, Lucas M, Schnure A, Ogawa F, Sato S, Takehara K, Fujimoto M, Kuwana M
Arthritis care & research 2014 Apr;66(4):575-84
Arthritis care & research 2014 Apr;66(4):575-84
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RUVBL1 expression in transfected 293T cell line by RUVBL1 monoclonal antibody (M01), clone 3G4-1F8.Lane 1: RUVBL1 transfected lysate (Predicted MW: 50.2 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RUVBL1 monoclonal antibody (M01), clone 3G4-1F8. Western Blot analysis of RUVBL1 expression in human pancreas.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RUVBL1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RUVBL1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between MAP3K7 and RUVBL1. HeLa cells were stained with anti-MAP3K7 rabbit purified polyclonal 1:1200 and anti-RUVBL1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)