HPA019948

RUVBL1 antibody from Sigma-Aldrich
ECP54, INO80H, NMP238, Pontin52, RVB1, TIH1, TIP49, TIP49a
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019948
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019948, RRID:AB_1856514
Product name
Anti-RUVBL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019948
Antibody type
Polyclonal
Antigen
RuvB-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GPPGTGKTALALAIAQELGSKVPFCPMVGSEVYST
EIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELT
PCETENPMGG
Storage
-20C
Provider Type Product Number
- No reagents -