HPA012606

NRCAM antibody from Sigma-Aldrich
Bravo, KIAA0343
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012606
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012606, RRID:AB_1854636
Product name
Anti-NRCAM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012606
Antibody type
Polyclonal
Antigen
Neuronal cell adhesion molecule Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REDYICYARFNHTQTIQQKQPISVKVISVDELNDT
IAANLSDTEFYGAKSSRERPPTFLTPEGNASNKEE
LRGNVLSLECIAEGLPTPIIYWAKEDGMLPKNRTV
YKNFEKTLQIIHVSEADSGNYQC
Storage
-20C
Provider Type Product Number
- No reagents -