HPA016757

SNAI3 antibody from Sigma-Aldrich
SMUC, Zfp293, ZNF293
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016757
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016757, RRID:AB_2191905
Product name
Anti-SNAI3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016757
Antibody type
Polyclonal
Antigen
Zinc finger protein SNAI3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPP
LLVLPTRWSPTLGPDRHGAPEKLLGAERMPRAPGG
FECFHCHKPYHTLAGLARHRQLH
Storage
-20C
Provider Type Product Number
- No reagents -