Antibody data
- Antibody Data
- Antigen structure
- References [9]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009958-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009958-M01, RRID:AB_425822
- Product name
- USP15 monoclonal antibody (M01), clone 1C10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant USP15.
- Antigen sequence
MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDS
RWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGL
LKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYT
LMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCE
NGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEK
ETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLV
IEQKNEDGTWPRGPSTPKKPLEQSC- Isotype
- IgG
- Antibody clone number
- 1C10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The deubiquitinating enzyme USP5 modulates neuropathic and inflammatory pain by enhancing Cav3.2 channel activity.
The deubiquitinase USP15 antagonizes Parkin-mediated mitochondrial ubiquitination and mitophagy.
The ubiquitin-specific protease USP15 promotes RIG-I-mediated antiviral signaling by deubiquitylating TRIM25.
The human COP9 signalosome protects ubiquitin-conjugating enzyme 3 (UBC3/Cdc34) from beta-transducin repeat-containing protein (betaTrCP)-mediated degradation.
The ubiquitin-specific peptidase USP15 regulates human papillomavirus type 16 E6 protein stability.
USP15 plays an essential role for caspase-3 activation during Paclitaxel-induced apoptosis.
COP9 signalosome interacts ATP-dependently with p97/valosin-containing protein (VCP) and controls the ubiquitination status of proteins bound to p97/VCP.
The COP9/signalosome increases the efficiency of von Hippel-Lindau protein ubiquitin ligase-mediated hypoxia-inducible factor-alpha ubiquitination.
CSN controls NF-kappaB by deubiquitinylation of IkappaBalpha.
García-Caballero A, Gadotti VM, Stemkowski P, Weiss N, Souza IA, Hodgkinson V, Bladen C, Chen L, Hamid J, Pizzoccaro A, Deage M, François A, Bourinet E, Zamponi GW
Neuron 2014 Sep 3;83(5):1144-58
Neuron 2014 Sep 3;83(5):1144-58
The deubiquitinase USP15 antagonizes Parkin-mediated mitochondrial ubiquitination and mitophagy.
Cornelissen T, Haddad D, Wauters F, Van Humbeeck C, Mandemakers W, Koentjoro B, Sue C, Gevaert K, De Strooper B, Verstreken P, Vandenberghe W
Human molecular genetics 2014 Oct 1;23(19):5227-42
Human molecular genetics 2014 Oct 1;23(19):5227-42
The ubiquitin-specific protease USP15 promotes RIG-I-mediated antiviral signaling by deubiquitylating TRIM25.
Pauli EK, Chan YK, Davis ME, Gableske S, Wang MK, Feister KF, Gack MU
Science signaling 2014 Jan 7;7(307):ra3
Science signaling 2014 Jan 7;7(307):ra3
The human COP9 signalosome protects ubiquitin-conjugating enzyme 3 (UBC3/Cdc34) from beta-transducin repeat-containing protein (betaTrCP)-mediated degradation.
Fernandez-Sanchez ME, Sechet E, Margottin-Goguet F, Rogge L, Bianchi E
The Journal of biological chemistry 2010 Jun 4;285(23):17390-7
The Journal of biological chemistry 2010 Jun 4;285(23):17390-7
The ubiquitin-specific peptidase USP15 regulates human papillomavirus type 16 E6 protein stability.
Vos RM, Altreuter J, White EA, Howley PM
Journal of virology 2009 Sep;83(17):8885-92
Journal of virology 2009 Sep;83(17):8885-92
USP15 plays an essential role for caspase-3 activation during Paclitaxel-induced apoptosis.
Xu M, Takanashi M, Oikawa K, Tanaka M, Nishi H, Isaka K, Kudo M, Kuroda M
Biochemical and biophysical research communications 2009 Oct 16;388(2):366-71
Biochemical and biophysical research communications 2009 Oct 16;388(2):366-71
COP9 signalosome interacts ATP-dependently with p97/valosin-containing protein (VCP) and controls the ubiquitination status of proteins bound to p97/VCP.
Cayli S, Klug J, Chapiro J, Fröhlich S, Krasteva G, Orel L, Meinhardt A
The Journal of biological chemistry 2009 Dec 11;284(50):34944-53
The Journal of biological chemistry 2009 Dec 11;284(50):34944-53
The COP9/signalosome increases the efficiency of von Hippel-Lindau protein ubiquitin ligase-mediated hypoxia-inducible factor-alpha ubiquitination.
Miyauchi Y, Kato M, Tokunaga F, Iwai K
The Journal of biological chemistry 2008 Jun 13;283(24):16622-31
The Journal of biological chemistry 2008 Jun 13;283(24):16622-31
CSN controls NF-kappaB by deubiquitinylation of IkappaBalpha.
Schweitzer K, Bozko PM, Dubiel W, Naumann M
The EMBO journal 2007 Mar 21;26(6):1532-41
The EMBO journal 2007 Mar 21;26(6):1532-41
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- USP15 monoclonal antibody (M01), clone 1C10 Western Blot analysis of USP15 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of USP15 expression in transfected 293T cell line by USP15 monoclonal antibody (M01), clone 1C10.Lane 1: USP15 transfected lysate (Predicted MW: 109.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged USP15 is 0.3 ng/ml as a capture antibody.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to USP15 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol