HPA006237

USP15 antibody from Sigma-Aldrich
KIAA0529, UNPH4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006237
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006237, RRID:AB_1080502
Product name
Anti-USP15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006237
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IFAMDENLSSIMERDDIYVFEININRTEDTEHVII
PVCLREKFRHSSYTHHTGSSLFGQPFLMAVPRNNT
EDKLYNLLLLRMCRYVKISTETEETEGSLHCCKDQ
NINGNGPNGIHEEGSPSEMETD
Storage
-20C
Provider Type Product Number
- No reagents -