HPA019486

ING2 antibody from Atlas Antibodies
ING1L, p33ING2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019486
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019486, RRID:AB_1851780
Product name
Anti-ING2
Provider product page
Atlas Antibodies - HPA019486
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TQMLELVENRARQMELHSQCFQDPAESERASDKAK
MDSSQPERSSRRPRRQRTSESRDLCHMANGIEDCD
DQPPKEKKSKSAKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -