HPA019486

ING2 antibody from Sigma-Aldrich
ING1L, p33ING2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019486
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019486, RRID:AB_1851780
Product name
Anti-ING2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019486
Antibody type
Polyclonal
Antigen
Inhibitor of growth protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TQMLELVENRARQMELHSQCFQDPAESERASDKAK
MDSSQPERSSRRPRRQRTSESRDLCHMANGIEDCD
DQPPKEKKSKSAKK
Storage
-20C
Provider Type Product Number
- No reagents -