HPA020381

SLC25A25 antibody from Atlas Antibodies
KIAA1896, MCSC, PCSCL
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020381
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020381, RRID:AB_1857037
Product name
Anti-SLC25A25
Provider product page
Atlas Antibodies - HPA020381
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQ
QAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIP
EIILYWKHSTIFDVGENLT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -