HPA020659

SLCO2B1 antibody from Atlas Antibodies
OATP-B, OATP2B1, SLC21A9
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020659
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020659, RRID:AB_1857219
Product name
Anti-SLCO2B1
Provider product page
Atlas Antibodies - HPA020659
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDP
STRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSC
VVEGNPVLAGSCDSTCSHLVVPF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -