Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405607 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Organic Anion Transporter Family, Member 2B1 (SLCO2B1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLCO2B1 antibody: synthetic peptide directed towards the N terminal of human SLCO2B1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLK
SSIST VEKRFGLSSQ- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Influence of SLCO1B1, 1B3, 2B1 and ABCC2 genetic polymorphisms on mycophenolic acid pharmacokinetics in Japanese renal transplant recipients.
Miura M, Satoh S, Inoue K, Kagaya H, Saito M, Inoue T, Suzuki T, Habuchi T
European journal of clinical pharmacology 2007 Dec;63(12):1161-9
European journal of clinical pharmacology 2007 Dec;63(12):1161-9
No comments: Submit comment
No validations: Submit validation data